PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo9G0019700
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family GRAS
Protein Properties Length: 450aa    MW: 48861.9 Da    PI: 6.5548
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo9G0019700genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS311.61.8e-95634462373
            GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalkl.......fsevsP 89 
                     ++lL++cA a++s+d++laq++L+ l+++a pdgdp+qRl++ +++AL +r +r  s+++++l++ + + ++   +++++++       f +++P
  Spipo9G0019700  63 EQLLVHCAIAIHSNDATLAQQILWVLHNIAPPDGDPTQRLTSAILRALTSRASR--SGTFSSLAAVAGAGDS-GAVAHSHRFsplslaaFLDLTP 154
                     79****************************************************..7888888777776444.3333333323334477****** PP

            GRAS  90 ilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg...skeeleetgerLakfAeelgvpfefnvl 181
                     +++f++ +aN aIl+aveg   vHi+D++ ++++Q p+L++aLa Rpegpp l++T+ + +++       + ee+g++L +fA++ +v +ef+++
  Spipo9G0019700 155 WHRFGYSAANAAILDAVEGLPVVHIVDLSTTHCMQMPTLIDALAGRPEGPPFLKLTVADWAAAPpptIDVSCEEIGRKLVNFARSRHVAMEFKAV 249
                     *********************************************************99866557778999************************ PP

            GRAS 182 .......vakrledleleeLrvkp......gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealey 263
                                 ++l +++Lrv++      gEal+Vn++++lh+++ e+++++ +r e+Lk+v++l+P  v++ve++ad++s+++++r+  a++y
  Spipo9G0019700 250 pcepsdgF----AAL-IDHLRVQQqlvlcdGEALVVNCQMKLHYIP-ETAESPARRAEFLKAVRGLNPAAVTLVEEDADLSSGDLVARLRTAFNY 338
                     76533333....333.55666655566666***************9.88888889**************************************** PP

            GRAS 264 ysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgsl 358
                      ++ +d+ ea lpr se+r+++E e + ++i+n++aceg +r+er e+ ++W +r++++GF+ vp++e+a++++k++l +++  g+ +++e++ +
  Spipo9G0019700 339 LWVHYDAAEAVLPRGSEQRRWYEGE-VMWKIENLLACEGLQRVERPEERSRWAKRMKAVGFQGVPFGEEAVAEVKSMLDEHA-AGWGMKKEEEGI 431
                     *************************.889*****************************************************.889999999*** PP

            GRAS 359 vlgWkdrpLvsvSaW 373
                     +l+Wk++++v++++W
  Spipo9G0019700 432 LLTWKGHNVVFATVW 446
                     *************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098545.94836428IPR005202Transcription factor GRAS
PfamPF035146.2E-9363446IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 450 aa     Download sequence    Send to blast
MMQYTEAATP AAPPLHHGGG RSSLSLDLPT KLSGPLLHRG RPWPGFPSST KSLGSFNTAS  60
CMEQLLVHCA IAIHSNDATL AQQILWVLHN IAPPDGDPTQ RLTSAILRAL TSRASRSGTF  120
SSLAAVAGAG DSGAVAHSHR FSPLSLAAFL DLTPWHRFGY SAANAAILDA VEGLPVVHIV  180
DLSTTHCMQM PTLIDALAGR PEGPPFLKLT VADWAAAPPP TIDVSCEEIG RKLVNFARSR  240
HVAMEFKAVP CEPSDGFAAL IDHLRVQQQL VLCDGEALVV NCQMKLHYIP ETAESPARRA  300
EFLKAVRGLN PAAVTLVEED ADLSSGDLVA RLRTAFNYLW VHYDAAEAVL PRGSEQRRWY  360
EGEVMWKIEN LLACEGLQRV ERPEERSRWA KRMKAVGFQG VPFGEEAVAE VKSMLDEHAA  420
GWGMKKEEEG ILLTWKGHNV VFATVWVPC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-22644466374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006426063.10.0hypothetical protein CICLE_v10025567mg
SwissprotQ9SN221e-159SCL32_ARATH; Scarecrow-like protein 32
TrEMBLA0A067GH430.0A0A067GH43_CITSI; Uncharacterized protein
TrEMBLV4RWS10.0V4RWS1_9R
STRINGGSMUA_Achr6P07790_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP56973759
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49950.11e-157GRAS family protein